ATG7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0691T
Article Name: ATG7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0691T
Supplier Catalog Number: CNA0691T
Alternative Catalog Number: MBL-CNA0691T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-676 of human ATG7 (NP_006386.1).
Conjugation: Unconjugated
Alternative Names: GSA7, APG7L, SCAR31, APG7-LIKE
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 10533
UniProt: O95352
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEGGYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYEREGFNFLAKVFNSSHSFL
Target: ATG7
Application Dilute: WB: IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200