MGMT Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0693P
Article Name: MGMT Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0693P
Supplier Catalog Number: CNA0693P
Alternative Catalog Number: MBL-CNA0693P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-180 of human MGMT (NP_002403.2).
Conjugation: Unconjugated
Alternative Names: MGMT
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 4255
UniProt: P16455
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVV
Target: MGMT
Application Dilute: WB: WB,1:500 - 1:1000