MMP7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0695T
Article Name: MMP7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0695T
Supplier Catalog Number: CNA0695T
Alternative Catalog Number: MBL-CNA0695T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MMP7 (NP_002414.1).
Conjugation: Unconjugated
Alternative Names: MMP-7, MPSL1, PUMP-1
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 4316
UniProt: P09237
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWG
Target: MMP7
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500