Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0696S
Article Name: |
Integrin alpha 4 (ITGA4/CD49d) Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0696S |
Supplier Catalog Number: |
CNA0696S |
Alternative Catalog Number: |
MBL-CNA0696S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 770-970 of human Integrin alpha 4 (ITGA4/CD49d) (NP_000876.3). |
Conjugation: |
Unconjugated |
Alternative Names: |
IA4, CD49D |
Clonality: |
Polyclonal |
Molecular Weight: |
115kDa |
NCBI: |
3676 |
UniProt: |
P13612 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
LKYEVKLTVHGFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLFNILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQ |
Target: |
ITGA4 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |