ANGPT2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0698T
Article Name: ANGPT2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0698T
Supplier Catalog Number: CNA0698T
Alternative Catalog Number: MBL-CNA0698T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 197-496 of human ANGPT2 (NP_001138.1).
Conjugation: Unconjugated
Alternative Names: ANG2, AGPT2, LMPHM10
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 285
UniProt: O15123
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: AMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDAC
Target: ANGPT2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200