Desmin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0699P
Article Name: Desmin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0699P
Supplier Catalog Number: CNA0699P
Alternative Catalog Number: MBL-CNA0699P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-470 of human Desmin (NP_001918.3).
Conjugation: Unconjugated
Alternative Names: CSM1, CSM2, CDCD3, LGMD1D, LGMD1E, LGMD2R
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 1674
UniProt: P17661
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: DFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTND
Target: DES
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200