HBG1/2 Rabbit mAb, Clone: [ARC1838], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0704S
Article Name: HBG1/2 Rabbit mAb, Clone: [ARC1838], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0704S
Supplier Catalog Number: CNA0704S
Alternative Catalog Number: MBL-CNA0704S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HBG1 (P69891).
Conjugation: Unconjugated
Alternative Names: HBG-T2, HBGA, HBGR, HSGGL1, PRO2979
Clonality: Monoclonal
Clone Designation: [ARC1838]
Molecular Weight: 12kDa
NCBI: 3047
UniProt: P69891
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD
Target: HBG1/2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200