TGF beta Receptor I (TGFBR1) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TGF beta Receptor I (TGFBR1) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA0708S
• Supplier Catalog Number: CNA0708S
• Alternative Catalog Number: MBL-CNA0708S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 34-124 of human TGF beta Receptor I (TGF beta Receptor I (TGFBR1)) (NP_001124388.1).
• Conjugation: Unconjugated
• Alternative Names: AAT5, ALK5, ESS1, LDS1, MSSE, SKR4, TBRI, ALK-5, LDS1A, LDS2A, TBR-i, TGFR-1, ACVRLK4, tbetaR-I

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 56kDa
• NCBI: 7046
• UniProt: P36897
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTI
• Target: TGFBR1

Application Notes

• Application Dilute: WB: WB,1:500 - 1:1000