TSC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0720S
Article Name: TSC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0720S
Supplier Catalog Number: CNA0720S
Alternative Catalog Number: MBL-CNA0720S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TSC1 (NP_000359.1).
Conjugation: Unconjugated
Alternative Names: LAM, TSC
Clonality: Polyclonal
Molecular Weight: 130kDa
NCBI: 7248
UniProt: Q92574
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: QAFTPIDLPCGSADESPAGDRECQTSLETSIFTPSPCKIPPPTRVGFGSGQPPPYDHLFEVALPKTAHHFVIRKTEELLKKAKGNTEEDGVPSTSPMEVLD
Target: TSC1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100