MAGE-1/MAGE1A Rabbit mAb, Clone: [ARC1839], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0723S
| Article Name: |
MAGE-1/MAGE1A Rabbit mAb, Clone: [ARC1839], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA0723S |
| Supplier Catalog Number: |
CNA0723S |
| Alternative Catalog Number: |
MBL-CNA0723S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-309 of human MAGE-1/MAGE1A (P43355). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CT1.1, MAGE1 |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC1839] |
| Molecular Weight: |
34kDa |
| NCBI: |
4100 |
| UniProt: |
P43355 |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
VMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV |
| Target: |
MAGEA1 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
