SUOX Rabbit mAb, Clone: [ARC2535], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA0733S
Article Name: |
SUOX Rabbit mAb, Clone: [ARC2535], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA0733S |
Supplier Catalog Number: |
CNA0733S |
Alternative Catalog Number: |
MBL-CNA0733S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUOX (P51687). |
Conjugation: |
Unconjugated |
Alternative Names: |
SUOX, sulfite oxidase |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC2535] |
Molecular Weight: |
60kDa |
NCBI: |
6821 |
UniProt: |
P51687 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
IWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPP |
Target: |
SUOX |
Application Dilute: |
WB: WB,1:500 - 1:1000 |