[KO Validated] NF2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0739S
Article Name: [KO Validated] NF2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0739S
Supplier Catalog Number: CNA0739S
Alternative Catalog Number: MBL-CNA0739S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1).
Conjugation: Unconjugated
Alternative Names: ACN, SCH, BANF, merlin-1
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 4771
UniProt: P35240
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Target: NF2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000