STAT6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0755P
Article Name: STAT6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0755P
Supplier Catalog Number: CNA0755P
Alternative Catalog Number: MBL-CNA0755P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human STAT6 (NP_003144.3).
Conjugation: Unconjugated
Alternative Names: STAT6B, STAT6C, D12S1644, IL-4-STAT
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 6778
UniProt: P42226
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTV
Target: STAT6
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200