CD34 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0761P
Article Name: CD34 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0761P
Supplier Catalog Number: CNA0761P
Alternative Catalog Number: MBL-CNA0761P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 32-290 of human CD34 (NP_001020280.1).
Conjugation: Unconjugated
Alternative Names: CD34,CD34 molecule,GIG3,MORT1
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 947
UniProt: P28906
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQS
Target: CD34
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200