ALK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0766T
Article Name: ALK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0766T
Supplier Catalog Number: CNA0766T
Alternative Catalog Number: MBL-CNA0766T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1550-1620 of human ALK (NP_004295.2).
Conjugation: Unconjugated
Alternative Names: ALK1, CD246, NBLST3
Clonality: Polyclonal
Molecular Weight: 176kDa
NCBI: 238
UniProt: Q9UM73
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Target: ALK
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100