hnRNP K Rabbit mAb, Clone: [ARC0512], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0772S
Article Name: hnRNP K Rabbit mAb, Clone: [ARC0512], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0772S
Supplier Catalog Number: CNA0772S
Alternative Catalog Number: MBL-CNA0772S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978).
Conjugation: Unconjugated
Alternative Names: AUKS, CSBP, TUNP, HNRPK
Clonality: Monoclonal
Clone Designation: [ARC0512]
Molecular Weight: 49kDa/51kDa
Sensitivity: 0.75 mg/mL
NCBI: 3190
UniProt: P61978
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Target: HNRNPK
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200