Erlin-2 Rabbit mAb, Clone: [ARC2538], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0781S
Article Name: Erlin-2 Rabbit mAb, Clone: [ARC2538], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0781S
Supplier Catalog Number: CNA0781S
Alternative Catalog Number: MBL-CNA0781S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Erlin-2 (O94905).
Conjugation: Unconjugated
Alternative Names: NET32, SPFH2, SPG18, C8orf2, Erlin-2
Clonality: Monoclonal
Clone Designation: [ARC2538]
Molecular Weight: 38kDa
NCBI: 11160
UniProt: O94905
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: HLMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKL
Target: ERLIN2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200