SBDS Rabbit mAb, Clone: [ARC2539], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0796S
Article Name: SBDS Rabbit mAb, Clone: [ARC2539], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0796S
Supplier Catalog Number: CNA0796S
Alternative Catalog Number: MBL-CNA0796S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 151-250 of human SBDS (NP_057122.2).
Conjugation: Unconjugated
Alternative Names: SDS, SDO1, SWDS, CGI-97
Clonality: Monoclonal
Clone Designation: [ARC2539]
Molecular Weight: 29kDa
NCBI: 51119
UniProt: Q9Y3A5
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Target: SBDS
Application Dilute: WB: WB,1:1000 - 1:5000