PKA C-alpha (PRKACA) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0798P
Article Name: PKA C-alpha (PRKACA) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0798P
Supplier Catalog Number: CNA0798P
Alternative Catalog Number: MBL-CNA0798P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-351 of human PKA C-alpha (PRKACA) (NP_002721.1).
Conjugation: Unconjugated
Alternative Names: CAFD1, PKACA, PPNAD4
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 5566
UniProt: P17612
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: KIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Target: PRKACA
Application Dilute: WB: WB,1:100 - 1:500