SR-BI Rabbit mAb, Clone: [ARC0334], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0827S
Article Name: SR-BI Rabbit mAb, Clone: [ARC0334], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0827S
Supplier Catalog Number: CNA0827S
Alternative Catalog Number: MBL-CNA0827S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0).
Conjugation: Unconjugated
Alternative Names: CLA1, SRB1, CLA-1, SR-BI, CD36L1, HDLCQ6, HDLQTL6
Clonality: Monoclonal
Clone Designation: [ARC0334]
Molecular Weight: 61kDa
Sensitivity: 0.5 mg/mL
NCBI: 949
UniProt: Q8WTV0
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK
Target: SCARB1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200