PDK1/PDHK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0834P
Article Name: PDK1/PDHK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0834P
Supplier Catalog Number: CNA0834P
Alternative Catalog Number: MBL-CNA0834P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 337-436 of human PDK1/PDHK1 (NP_002601.1).
Conjugation: Unconjugated
Alternative Names: PDK1
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 5163
UniProt: Q15118
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Target: PDK1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200