DDIT3/CHOP Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0854S
| Article Name: |
DDIT3/CHOP Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0854S |
| Supplier Catalog Number: |
CNA0854S |
| Alternative Catalog Number: |
MBL-CNA0854S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DDIT3/CHOP (NP_004074.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta |
| Clonality: |
Polyclonal |
| Molecular Weight: |
19kDa |
| NCBI: |
1649 |
| UniProt: |
P35638 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG |
| Target: |
DDIT3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
