TRAF3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0875S
Article Name: |
TRAF3 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA0875S |
Supplier Catalog Number: |
CNA0875S |
Alternative Catalog Number: |
MBL-CNA0875S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAF3 (NP_003291.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118 |
Clonality: |
Polyclonal |
Molecular Weight: |
64kDa |
NCBI: |
7187 |
UniProt: |
Q13114 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV |
Target: |
TRAF3 |
Application Dilute: |
WB: WB,1:200 - 1:1000 |