TRAF3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA0875S
| Article Name: |
TRAF3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA0875S |
| Supplier Catalog Number: |
CNA0875S |
| Alternative Catalog Number: |
MBL-CNA0875S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAF3 (NP_003291.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
CAP1, LAP1, CAP-1, CRAF1, IIAE5, CD40bp, RNF118 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
64kDa |
| NCBI: |
7187 |
| UniProt: |
Q13114 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKV |
| Target: |
TRAF3 |
| Application Dilute: |
WB: WB,1:200 - 1:1000 |
