Ku70 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0883S
Article Name: Ku70 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0883S
Supplier Catalog Number: CNA0883S
Alternative Catalog Number: MBL-CNA0883S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Ku70 (NP_001460.1).
Conjugation: Unconjugated
Alternative Names: ML8, KU70, TLAA, CTC75, CTCBF, G22P1
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 2547
UniProt: P12956
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
Target: XRCC6
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200