CDK9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0886S
Article Name: CDK9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0886S
Supplier Catalog Number: CNA0886S
Alternative Catalog Number: MBL-CNA0886S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 153-372 of human CDK9 (NP_001252.1).
Conjugation: Unconjugated
Alternative Names: TAK, C-2k, CTK1, CDC2L4, PITALRE
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 1025
UniProt: P50750
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: ANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
Target: CDK9
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200