[KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0887S
Article Name: [KO Validated] BRG1/SMARCA4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0887S
Supplier Catalog Number: CNA0887S
Alternative Catalog Number: MBL-CNA0887S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 30-130 of human BRG1/BRG1/SMARCA4 (NP_003063.2).
Conjugation: Unconjugated
Alternative Names: BRG1, CSS4, SNF2, SWI2, MRD16, RTPS2, BAF190, SNF2L4, SNF2LB, hSNF2b, BAF190A, SNF2-beta
Clonality: Polyclonal
Molecular Weight: 185kDa
NCBI: 6597
UniProt: P51532
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA
Target: SMARCA4
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50