SAE1 Rabbit mAb, Clone: [ARC1846], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0891S
Article Name: SAE1 Rabbit mAb, Clone: [ARC1846], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0891S
Supplier Catalog Number: CNA0891S
Alternative Catalog Number: MBL-CNA0891S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SAE1 (Q9UBE0).
Conjugation: Unconjugated
Alternative Names: AOS1, SUA1, UBLE1A, HSPC140
Clonality: Monoclonal
Clone Designation: [ARC1846]
Molecular Weight: 38kDa
NCBI: 10055
UniProt: Q9UBE0
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMA
Target: SAE1
Application Dilute: WB: WB,1:500 - 1:2000