PRKCSH Rabbit mAb, Clone: [ARC2549], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0894S
Article Name: PRKCSH Rabbit mAb, Clone: [ARC2549], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0894S
Supplier Catalog Number: CNA0894S
Alternative Catalog Number: MBL-CNA0894S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 429-528 of human PRKCSH (P14314).
Conjugation: Unconjugated
Alternative Names: GIIB, PCLD, PLD1, G19P1, PCLD1, PKCSH, AGE-R2, VASAP-60
Clonality: Monoclonal
Clone Designation: [ARC2549]
Molecular Weight: 59kDa
NCBI: 5589
UniProt: P14314
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELMTPAACPEPPPEAPTEDDHDEL
Target: PRKCSH
Application Dilute: WB: WB,1:500 - 1:1000