ILK Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0901S
Article Name: ILK Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0901S
Supplier Catalog Number: CNA0901S
Alternative Catalog Number: MBL-CNA0901S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human ILK (NP_001014795.1).
Conjugation: Unconjugated
Alternative Names: P59, ILK-1, ILK-2, p59ILK, HEL-S-28
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 3611
UniProt: Q13418
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVL
Target: ILK
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100