LEF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0909P
Article Name: LEF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0909P
Supplier Catalog Number: CNA0909P
Alternative Catalog Number: MBL-CNA0909P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-132 of human LEF1 (NP_057353.1).
Conjugation: Unconjugated
Alternative Names: LEF-1, TCF10, TCF7L3, TCF1ALPHA
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 51176
UniProt: Q9UJU2
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLS
Target: LEF1
Application Dilute: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000|IF/ICC,1:50 - 1:200