EAAT2/SLC1A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0910S
Article Name: EAAT2/SLC1A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0910S
Supplier Catalog Number: CNA0910S
Alternative Catalog Number: MBL-CNA0910S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 495-574 of human EAAT2/EAAT2/SLC1A2 (NP_004162.2).
Conjugation: Unconjugated
Alternative Names: GLT1, HBGT, DEE41, EAAT2, GLT-1, EIEE41
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 6506
UniProt: P43004
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: HLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Target: SLC1A2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200