HES1 Rabbit mAb, Clone: [ARC0513], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0925S
Article Name: HES1 Rabbit mAb, Clone: [ARC0513], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0925S
Supplier Catalog Number: CNA0925S
Alternative Catalog Number: MBL-CNA0925S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 181-280 of human HES1 (Q14469).
Conjugation: Unconjugated
Alternative Names: HHL, HRY, HES-1, bHLHb39
Clonality: Monoclonal
Clone Designation: [ARC0513]
Molecular Weight: 30kDa
NCBI: 3280
UniProt: Q14469
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Target: HES1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500