Filamin A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0927S
Article Name: Filamin A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0927S
Supplier Catalog Number: CNA0927S
Alternative Catalog Number: MBL-CNA0927S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2348-2647 of human Filamin A (NP_001104026.1).
Conjugation: Unconjugated
Alternative Names: FLN, FMD, MNS, OPD, ABPX, CSBS, CVD1, FGS2, FLN1, NHBP, OPD1, OPD2, XLVD, XMVD, FLN-A, ABP-280
Clonality: Polyclonal
Molecular Weight: 281kDa
NCBI: 2316
UniProt: P21333
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPC
Target: FLNA
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100