NCF4/p40-phox Rabbit mAb, Clone: [ARC2553], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0935S
Article Name: NCF4/p40-phox Rabbit mAb, Clone: [ARC2553], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0935S
Supplier Catalog Number: CNA0935S
Alternative Catalog Number: MBL-CNA0935S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 240-339 of human NCF4/p40-phox (Q15080).
Conjugation: Unconjugated
Alternative Names: NCF, CGD3, P40PHOX, SH3PXD4
Clonality: Monoclonal
Clone Designation: [ARC2553]
Molecular Weight: 39kDa
Sensitivity: 0.8 mg/mL
NCBI: 4689
UniProt: Q15080
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Target: NCF4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000