HFE Rabbit mAb, Clone: [ARC2554], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0937S
Article Name: HFE Rabbit mAb, Clone: [ARC2554], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0937S
Supplier Catalog Number: CNA0937S
Alternative Catalog Number: MBL-CNA0937S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 249-348 of human HFE (Q30201).
Conjugation: Unconjugated
Alternative Names: HH, HFE1, HLA-H, MVCD7, TFQTL2
Clonality: Monoclonal
Clone Designation: [ARC2554]
Molecular Weight: 40kDa
NCBI: 3077
UniProt: Q30201
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE
Target: HFE
Application Dilute: WB: WB,1:500 - 1:1000