PARP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0942T
Article Name: PARP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0942T
Supplier Catalog Number: CNA0942T
Alternative Catalog Number: MBL-CNA0942T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PARP1 (NP_001609.2).
Conjugation: Unconjugated
Alternative Names: PARP, PARS, PPOL, ADPRT, ARTD1, ADPRT1, PARP-1, ADPRT 1, pADPRT-1, Poly-PARP
Clonality: Polyclonal
Molecular Weight: 113kDa
NCBI: 142
UniProt: P09874
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
Target: PARP1
Application Dilute: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200