[KO Validated] ErbB3/HER3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0950P
Article Name: [KO Validated] ErbB3/HER3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0950P
Supplier Catalog Number: CNA0950P
Alternative Catalog Number: MBL-CNA0950P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2).
Conjugation: Unconjugated
Alternative Names: HER3, FERLK, LCCS2, VSCN1, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3
Clonality: Polyclonal
Molecular Weight: 148kDa
NCBI: 2065
UniProt: P21860
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: DYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT
Target: ERBB3
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200