NeuN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0951T
Article Name: NeuN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0951T
Supplier Catalog Number: CNA0951T
Alternative Catalog Number: MBL-CNA0951T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of NeuN (NP_001076044.1).
Conjugation: Unconjugated
Alternative Names: FOX3, NEUN, FOX-3, HRNBP3
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 146713
UniProt: A6NFN3
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Target: RBFOX3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200