Olig1 Rabbit mAb, Clone: [ARC1850], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0953S
Article Name: Olig1 Rabbit mAb, Clone: [ARC1850], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0953S
Supplier Catalog Number: CNA0953S
Alternative Catalog Number: MBL-CNA0953S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 172-271 of human Olig1 (Q8TAK6).
Conjugation: Unconjugated
Alternative Names: BHLHB6, BHLHE21
Clonality: Monoclonal
Clone Designation: [ARC1850]
Molecular Weight: 28kDa
NCBI: 116448
UniProt: Q8TAK6
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Target: OLIG1
Application Dilute: WB: WB,1:500 - 1:1000