PPP3R1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0954S
Article Name: PPP3R1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0954S
Supplier Catalog Number: CNA0954S
Alternative Catalog Number: MBL-CNA0954S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-170 of human PPP3R1 (NP_000936.1).
Conjugation: Unconjugated
Alternative Names: CNB, CNB1, CALNB1
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 5534
UniProt: P63098
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Target: PPP3R1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200