SFPQ Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0958S
Article Name: SFPQ Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0958S
Supplier Catalog Number: CNA0958S
Alternative Catalog Number: MBL-CNA0958S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 578-707 of human SFPQ (NP_005057.1).
Conjugation: Unconjugated
Alternative Names: PSF, POMP100, PPP1R140
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 6421
UniProt: P23246
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Target: SFPQ
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|IP,1:500 - 1:1000