ERAB/HSD17B10 Rabbit mAb, Clone: [ARC1852], Unconjugated, Monoclonal

Catalog Number: MBL-CNA0959S
Article Name: ERAB/HSD17B10 Rabbit mAb, Clone: [ARC1852], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA0959S
Supplier Catalog Number: CNA0959S
Alternative Catalog Number: MBL-CNA0959S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human ERAB/HSD17B10 (Q99714).
Conjugation: Unconjugated
Alternative Names: ABAD, CAMR, ERAB, HCD2, MHBD, HADH2, MRPP2, MRX17, MRX31, SCHAD, MRXS10, SDR5C1, HSD10MD, 17b-HSD10, DUPXp11.22
Clonality: Monoclonal
Clone Designation: [ARC1852]
Molecular Weight: 27kDa
NCBI: 3028
UniProt: Q99714
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Target: HSD17B10
Application Dilute: WB: WB,1:500 - 1:1000