gamma-Catenin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0963S
Article Name: gamma-Catenin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0963S
Supplier Catalog Number: CNA0963S
Alternative Catalog Number: MBL-CNA0963S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human gamma-Catenin (NP_002221.1).
Conjugation: Unconjugated
Alternative Names: PG, DP3, PDGB, PKGB, CTNNG, DPIII
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 3728
UniProt: P14923
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLL
Target: JUP
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:50 - 1:100