SNX9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0977T
Article Name: SNX9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0977T
Supplier Catalog Number: CNA0977T
Alternative Catalog Number: MBL-CNA0977T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human SNX9 (NP_057308.1).
Conjugation: Unconjugated
Alternative Names: SDP1, WISP, SH3PX1, SH3PXD3A
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 51429
UniProt: Q9Y5X1
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG
Target: SNX9
Application Dilute: WB: WB,1:500 - 1:2000