WASP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0978S
Article Name: WASP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0978S
Supplier Catalog Number: CNA0978S
Alternative Catalog Number: MBL-CNA0978S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WASPP (NP_000368.1).
Conjugation: Unconjugated
Alternative Names: THC, IMD2, SCNX, THC1, WASP, WASPA
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 7454
UniProt: P42768
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHV
Target: WAS
Application Dilute: WB: WB,1:500 - 1:2000