MyD88 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0980T
Article Name: MyD88 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0980T
Supplier Catalog Number: CNA0980T
Alternative Catalog Number: MBL-CNA0980T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_001166038.2).
Conjugation: Unconjugated
Alternative Names: WM1, IMD68, MYD88D
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 4615
UniProt: Q99836
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
Target: MYD88
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200