MSH6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0983T
Article Name: MSH6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0983T
Supplier Catalog Number: CNA0983T
Alternative Catalog Number: MBL-CNA0983T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSH6 (NP_000170.1).
Conjugation: Unconjugated
Alternative Names: GTBP, HSAP, p160, GTMBP, MSH-6, HNPCC5, LYNCH5, MMRCS3
Clonality: Polyclonal
Molecular Weight: 153kDa
NCBI: 2956
UniProt: P52701
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKM
Target: MSH6
Application Dilute: WB: WB,1:500 - 1:1000