NEK8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0984P
Article Name: NEK8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0984P
Supplier Catalog Number: CNA0984P
Alternative Catalog Number: MBL-CNA0984P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1).
Conjugation: Unconjugated
Alternative Names: JCK, NPHP9, RHPD2, NEK12A
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 284086
UniProt: Q86SG6
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
Target: NEK8
Application Dilute: WB: WB,1:100 - 1:500