SYT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0992T
Article Name: SYT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0992T
Supplier Catalog Number: CNA0992T
Alternative Catalog Number: MBL-CNA0992T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 84-157 of human SYT1 (NP_005630.1).
Conjugation: Unconjugated
Alternative Names: P65, SYT, BAGOS, SVP65
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 6857
UniProt: P21579
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
Target: SYT1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200