Hexokinase II Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA0994P
Article Name: Hexokinase II Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA0994P
Supplier Catalog Number: CNA0994P
Alternative Catalog Number: MBL-CNA0994P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Hexokinase II (NP_000180.2).
Conjugation: Unconjugated
Alternative Names: HKII, HXK2
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 3099
UniProt: P52789
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
Target: HK2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200